Question

The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the proteins at the carboxyl sides of the amino acids lysine or arginine. The products of the digestion are then subjected to ESI TOF-MS in positive ion mode with the peptides in a pH 2 solution. a. Calculate the mass of each cleavage product based on their amino acid sequence and determine their predominant charge state at pH 2. Which product will reach the detector first

Answer 1

Follows are the solution to this question:

Step-by-step explanation:

The creation of four fragments,

(n endpoint) MNQSYGR (c endpoint)

Weight of the molecular = 854.92

Load = 2

`\to (mass)/(Load)` = 427.46

(n endpoint)RLVSR (c endpoint)

Weight of the molecular = 629.76

Load = 3

`\to (mass)/(Load)`= 209.92

(n endpoint) AATAMASLIK (c endpoint)

Weight of the molecular = 976.20

Load at pH(2). = 2

`\to (mass)/(Load)`= 442.50

(n endpoint) IFAWWY (c endpoint)

Weight of the molecular = 885.03

Load= 1

`\to (mass)/(Load)`= 885.03

It is apparent that RLVSR is the smallest mass ration for this peptide that is detected in the first place.